PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B02459.1.p
Common NameEUGRSUZ_B02459
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 379aa    MW: 41959.8 Da    PI: 7.358
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B02459.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-3999160263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       +e+al+cprC+stntkfCyynnysl qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++sss
  Eucgr.B02459.1.p  99 PEEALHCPRCESTNTKFCYYNNYSLLQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNRRSSS 160
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-25100155IPR003851Zinc finger, Dof-type
PfamPF027015.6E-33101157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.91103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MFLCFHFLSG GLILCFFIFL LFFGAYLMFS GTRGYPTQHL ISPLSLSLSC PNHKFGFAVF  60
SACMDPSSGT NQEMGAHSLE SMLISPKPQQ DQRKPRPQPE EALHCPRCES TNTKFCYYNN  120
YSLLQPRYFC KSCRRYWTKG GTLRNVPVGG GCRKNRRSSS SSSSRRAQDQ GGPISTLINN  180
NDYDTPNPFT TLHSLTYDQS SDHMSLPFLG LHKFPYQLGP HELSHDILSY ANRSKNGHGD  240
MNGGFLDSLK NEFGLLENTQ NNVHDSHHRQ NLYYGYGSDG MHNNMGDPVD SGGAPSSCDH  300
EMMSPAGSAN EALGATSMKQ ELLCSDRDGE NRVFWGCPWQ MNGDQYRGNG VIGDVNSGRG  360
SWNGLGSSWY GLLNSPLV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B02459.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4498733e-34AM449873.2 Vitis vinifera contig VV78X180438.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043694.10.0PREDICTED: dof zinc finger protein DOF2.1
TrEMBLA0A059D5B30.0A0A059D5B3_EUCGR; Uncharacterized protein
STRINGGLYMA12G07710.15e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.11e-45Dof family protein